Pentraxin 2/SAP Antibody (4E8.)

Images

 
Sandwich ELISA: Pentraxin 2/SAP Antibody (4E8) [H00000325-M07] - Detection limit for recombinant GST tagged APCS is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E8.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pentraxin 2/SAP Antibody (4E8.) Summary

Immunogen
APCS (NP_001630 117 a.a. - 223 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Specificity
APCS (4E8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APCS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pentraxin 2/SAP Antibody (4E8.)

  • 9.5S alpha-1-glycoprotein
  • amyloid P component, serum
  • APCS
  • MGC88159
  • Pentraxin 2
  • PTX2
  • PTX2serum amyloid P-component
  • SAP
  • SAPpentaxin-related

Background

The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu
Applications: WB, ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4779
Species: Hu
Applications: WB, IHC

Publications for Pentraxin 2/SAP Antibody (H00000325-M07) (0)

There are no publications for Pentraxin 2/SAP Antibody (H00000325-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 2/SAP Antibody (H00000325-M07) (0)

There are no reviews for Pentraxin 2/SAP Antibody (H00000325-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pentraxin 2/SAP Antibody (H00000325-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pentraxin 2/SAP Products

Bioinformatics Tool for Pentraxin 2/SAP Antibody (H00000325-M07)

Discover related pathways, diseases and genes to Pentraxin 2/SAP Antibody (H00000325-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pentraxin 2/SAP Antibody (H00000325-M07)

Discover more about diseases related to Pentraxin 2/SAP Antibody (H00000325-M07).
 

Pathways for Pentraxin 2/SAP Antibody (H00000325-M07)

View related products by pathway.

Blogs on Pentraxin 2/SAP

There are no specific blogs for Pentraxin 2/SAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pentraxin 2/SAP Antibody (4E8.) and receive a gift card or discount.

Bioinformatics

Gene Symbol APCS
Entrez
OMIM
Uniprot