Peflin Antibody (1X2R7)

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] - Western blot analysis of various lysates using Peflin Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] - Western blot analysis of lysates from Mouse liver, using Peflin Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1X2R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Peflin Antibody (1X2R7) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Peflin (Q9UBV8).
  
  Sequence:
  APGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PEF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Peflin Antibody (1X2R7)

• ABP32
• PEF protein with a long N-terminal hydrophobic domain
• PEF1A
• peflin
• penta-EF hand domain containing 1
• Penta-EF hand domain-containing protein 1
• penta-EF-hand domain containing 1

Background

PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpainsmall subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM601057) (Kitaura et al., 2001 (PubMed 11278427)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEF1