PEA-15 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEA15. Source: E. coli
Amino Acid Sequence: PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PEA15 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62670. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PEA-15 Recombinant Protein Antigen
Background
PEA-15 (phosphoprotein enriched in astrocytes) exists in an non-phosphorylated form (N), and two phosphorylated forms, Pa and Pb. PEA-15 is an endogenous substrate for PKC, which mediates the transition from Pa to Pb. The level of PEA-15 phosphorylation changes upon depolymerization or stabilization of tubulins, indicating that PEA-15 co-localizes with microtubules. The first 80 amino acids of PEA-15 correspond to the death effector domain (DED), which is a domain found in proteins that regulate apoptotic signaling pathways. The DED domain is necessary for PEA-15 to block Ras suppression. Although PEA-15 is predominantly expressed in the central nervous system, low levels of PEA-15 are expressed in liver and kidney, and higher levels in muscle. PEA-15 is also referred to as PED, phosphoprotein enriched in diabetes, for its elevated expression in type 2 diabetic patients.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP) (0)
There are no publications for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP) (0)
There are no reviews for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP) (0)
Additional PEA-15 Products
Research Areas for PEA-15 Recombinant Protein Antigen (NBP2-62670PEP)
Find related products by research area.
|
Blogs on PEA-15