PDK-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKG |
| Predicted Species |
Mouse (93%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PDPK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PDK-1 Antibody - BSA Free
Background
PDK-1 (3-phosphoinositide-dependent protein kinase, gene name PDPK1) is a 58 -68 kDa, 556 amino acid (aa) monomeric protein of the AGC serine/threonine kinase family. It is activated by phosphorylation in the presence of PtdIns(3,4,5) P3 or PtdIns(3,4) P2. Akt, S6 kinases, PKA and PKC-zeta are reported PDK-1 substrates. Through Akt, PDK-1 mediates many of the intracellular actions of insulin. Within the region used as an immunogen, human PDK-1 shares 98% aa identity with mouse and rat PDK-1. One reported isoform has an alternate start site at aa 50, while another lacking aa 238-263 is predicted to be catalytically inactive.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Publications for PDK-1 Antibody (NBP2-48631) (0)
There are no publications for PDK-1 Antibody (NBP2-48631).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDK-1 Antibody (NBP2-48631) (0)
There are no reviews for PDK-1 Antibody (NBP2-48631).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PDK-1 Antibody (NBP2-48631) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PDK-1 Products
Research Areas for PDK-1 Antibody (NBP2-48631)
Find related products by research area.
|
Blogs on PDK-1