PDIK1L Antibody

Images

 
Western Blot: PDIK1L Antibody [NBP1-56733] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDIK1L Antibody Summary

Immunogen
Synthetic peptides corresponding to PDIK1L(PDLIM1 interacting kinase 1 like) The peptide sequence was selected from the middle region of PDIK1L. Peptide sequence TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIK1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDIK1L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDIK1L Antibody

  • casein kinase
  • CLIK1LRP11-96L14.4
  • EC 2.7.11.1
  • PDLIM1 interacting kinase 1 like
  • PDLIM1-interacting kinase 1-like
  • serine/threonine-protein kinase PDIK1L
  • STK35L2

Background

The specific function of PDIK1L is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52449
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NBP2-50030
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC
NBP2-16020
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-125
Species: Hu
Applications: WB, ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-56733
Species: Hu
Applications: WB

Publications for PDIK1L Antibody (NBP1-56733) (0)

There are no publications for PDIK1L Antibody (NBP1-56733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIK1L Antibody (NBP1-56733) (0)

There are no reviews for PDIK1L Antibody (NBP1-56733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDIK1L Antibody (NBP1-56733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDIK1L Antibody (NBP1-56733)

Discover related pathways, diseases and genes to PDIK1L Antibody (NBP1-56733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIK1L Antibody (NBP1-56733)

Discover more about diseases related to PDIK1L Antibody (NBP1-56733).
 

Pathways for PDIK1L Antibody (NBP1-56733)

View related products by pathway.

Blogs on PDIK1L

There are no specific blogs for PDIK1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDIK1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIK1L
Uniprot