PDE8A Antibody (1H6)

Images

 
Western Blot: PDE8A Antibody (1H6) [H00005151-M02] - Analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody (M02), clone 1H6.Lane 1: PDE8A transfected lysate(93.3 KDa).Lane 2: ...read more
Sandwich ELISA: PDE8A Antibody (1H6) [H00005151-M02] - Detection limit for recombinant GST tagged PDE8A is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDE8A Antibody (1H6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Specificity
PDE8A - phosphodiesterase 8A (1H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDE8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE8A Antibody (1H6)

  • cAMP-specific cyclic nucleotide phosphodiesterase 8A
  • EC 3.1.4.17
  • FLJ16150
  • high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • HsT19550
  • PDE8A
  • phosphodiesterase 8A

Background

Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDE8A Antibody (H00005151-M02) (0)

There are no publications for PDE8A Antibody (H00005151-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE8A Antibody (H00005151-M02) (0)

There are no reviews for PDE8A Antibody (H00005151-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE8A Antibody (H00005151-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE8A Products

Research Areas for PDE8A Antibody (H00005151-M02)

Find related products by research area.

Blogs on PDE8A

There are no specific blogs for PDE8A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE8A Antibody (1H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE8A
Entrez
Uniprot