PDE8A Antibody (1H6) - Azide and BSA Free

Western Blot: PDE8A Antibody (1H6) [H00005151-M02] - Analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody (M02), clone 1H6.Lane 1: PDE8A transfected lysate(93.3 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: PDE8A Antibody (1H6) [H00005151-M02] - Detection limit for recombinant GST tagged PDE8A is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDE8A Antibody (1H6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
• Specificity: PDE8A - phosphodiesterase 8A (1H6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDE8A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE8A Antibody (1H6) - Azide and BSA Free

• cAMP-specific cyclic nucleotide phosphodiesterase 8A
• EC 3.1.4.17
• FLJ16150
• high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• HsT19550
• PDE8A
• phosphodiesterase 8A

Background

Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE8A
• Entrez:
  • 5151(Human)
• Uniprot:
  • NP_002596(Human)