PDE6 beta Recombinant Protein Antigen

Images

 
There are currently no images for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDE6 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE6 beta.

Source: E. coli

Amino Acid Sequence: DRDEIQLILPTRARLGKEPADCDEDELGEILKEELPGPTTFDIYEFHFSDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE6B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58654.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE6 beta Recombinant Protein Antigen

  • CSNB3
  • EC 3.1.4
  • EC 3.1.4.35
  • GMP-PDE beta
  • PDE6 beta
  • PDE6B
  • PDEB
  • PDEBrod cGMP-phosphodiesterase beta-subunit
  • phosphodiesterase 6B, cGMP-specific, rod, beta
  • rd1
  • rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta
  • RP40CSNBAD2

Background

Photon absorption triggers a signaling cascade in rod photoreceptors that activates cGMP phosphodiesterase (PDE), resulting in the rapid hydrolysis of cGMP, closure of cGMP-gated cation channels, and hyperpolarization of the cell. PDE is a peripheral membrane heterotrimeric enzyme made up of alpha, beta, and gamma subunits. This gene encodes the beta subunit. Mutations in this gene result in retinitis pigmentosa and autosomal dominant congenital stationary night blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
NBP2-15343
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87312
Species: Hu, Pm, Mu
Applications: IHC,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-93029
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF2945
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-05423
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB

Publications for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP) (0)

There are no publications for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP) (0)

There are no reviews for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE6 beta Products

Research Areas for PDE6 beta Recombinant Protein Antigen (NBP2-58654PEP)

Find related products by research area.

Blogs on PDE6 beta

There are no specific blogs for PDE6 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDE6 beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE6B