PDE2A Antibody (4F4) - Azide and BSA Free

Western Blot: PDE2A Antibody (4F4) [H00005138-M01] - PDE2A monoclonal antibody (M01), clone 4F4 Analysis of PDE2A expression in IMR-32.

Sandwich ELISA: PDE2A Antibody (4F4) [H00005138-M01] - Detection limit for recombinant GST tagged PDE2A is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDE2A Antibody (4F4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PDE2A (NP_002590, 850 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
• Localization: Cell Membrane
• Specificity: PDE2A - phosphodiesterase 2A, cGMP-stimulated
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDE2A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE2A Antibody (4F4) - Azide and BSA Free

• cGMP-dependent 3'-5'-cyclic phosphodiesterase
• cGMP-stimulated phosphodiesterase 1
• cGMP-stimulated phosphodiesterase 4
• cGSPDE
• CGS-PDE
• Cyclic GMP-stimulated phosphodiesterase
• EC 3.1.4
• EC 3.1.4.17
• PDE2A
• PDE2A1
• PED2A4
• phosphodiesterase 2A, cGMP-stimulated

Background

Cyclic nucleotides are important intracellular second messengers which play an important role in a variety of signal transduction process. The cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodiesterases. One of the many phosphodiesterases that compartmentalize and hydrolyze cAMP and cGMP into AMP and GMP is PDE2. Two genes, PDE2A and PDE2B, have been identified and cloned and they both have an apparent molecular weight of 100 kDA. PDE2A has specificity for cAMP and its activity is modulated by the presence of cGMP. In contrast, PDE2B does not hydrolyze cGMP nor its activity is altered by the presence of cGMP. Western blot analyses of PDE2A reveals that it is present in a variety of tissues including neocortex, cerebellum, heart, kidney lungs, pulmonary artery and skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE2A
• Entrez:
  • 5138(Human)
• OMIM:
  • 602658(Human)
• Uniprot:
  • NP_002590(Human)