PDE10A Antibody

Images

 
Immunohistochemistry: PDE10A Antibody [NBP2-48869] - Staining of human lateral ventricle shows moderate positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE10A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVL
Specificity
Specificity of human PDE10A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE10A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDE10A Recombinant Protein Antigen (NBP2-48869PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE10A Antibody

  • cAMP and cAMP-inhibited cGMP 3'-5'-cyclic phosphodiesterase 10A
  • dJ416F21.1 (phosphodiesterase 10A)
  • EC 3.1.4
  • EC 3.1.4.17
  • EC 3.1.4.35
  • FLJ11894
  • FLJ25677
  • HSPDE10A
  • phosphodiesterase 10A
  • phosphodiesterase 10A1 (PDE10A1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65239
Species: Hu
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-644
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, ICC/IF, IHC, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37404
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-92265
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PDE10A Antibody (NBP2-48869) (0)

There are no publications for PDE10A Antibody (NBP2-48869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE10A Antibody (NBP2-48869) (0)

There are no reviews for PDE10A Antibody (NBP2-48869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDE10A Antibody (NBP2-48869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDE10A Antibody (NBP2-48869)

Discover related pathways, diseases and genes to PDE10A Antibody (NBP2-48869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE10A Antibody (NBP2-48869)

Discover more about diseases related to PDE10A Antibody (NBP2-48869).
 

Pathways for PDE10A Antibody (NBP2-48869)

View related products by pathway.

PTMs for PDE10A Antibody (NBP2-48869)

Learn more about PTMs related to PDE10A Antibody (NBP2-48869).

Blogs on PDE10A

There are no specific blogs for PDE10A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE10A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE10A