![Western Blot: PCSK1N Antibody [H00027344-B01P] - Analysis of PCSK1N expression in rat brain.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Western-Blot-H00027344-B01P-img0003.jpg "Western Blot: PCSK1N Antibody [H00027344-B01P] - Analysis of PCSK1N expression in rat brain.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PCSK1N Antibody - Azide and BSA Free (H00027344-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PCSK1N (NP_037403.1, 1 a.a. - 260 a.a.) full-length human protein. MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP |
| Specificity | Reacts with proprotein convertase subtilisin/kexin type 1 inhibitor. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PCSK1N |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCSK1N |
| Entrez |
|
| Uniprot |
|
![Western Blot: PCSK1N Antibody [H00027344-B01P] - Analysis of PCSK1N expression in transfected 293T cell line by PCSK1N polyclonal antibody. Lane 1: PCSK1N transfected lysate(28.6 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Western-Blot-H00027344-B01P-img0004.jpg "Western Blot: PCSK1N Antibody [H00027344-B01P] - Analysis of PCSK1N expression in transfected 293T cell line by PCSK1N polyclonal antibody. Lane 1: PCSK1N transfected lysate(28.6 KDa). Lane 2: Non-transfected lysate.")
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")