PCPE-1/PCOLCE Antibody


Western Blot: PCPE-1/PCOLCE Antibody [NBP1-58045] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PCPE-1/PCOLCE Antibody Summary

Synthetic peptides corresponding to PCOLCE(procollagen C-endopeptidase enhancer) The peptide sequence was selected from the middle region of PCOLCE (NP_002584). Peptide sequence LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-58045 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCPE-1/PCOLCE Antibody

  • PCPE
  • PCPE1
  • PCPE-1
  • PCPE1Type I procollagen COOH-terminal proteinase enhancer
  • procollagen C-endopeptidase enhancer 1
  • procollagen C-endopeptidase enhancer
  • Procollagen COOH-terminal proteinase enhancer 1
  • Procollagen C-proteinase enhancer 1
  • procollagen, type 1, COOH-terminal proteinase enhancer
  • Type 1 procollagen C-proteinase enhancer protein


PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP, ICC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB

Publications for PCPE-1/PCOLCE Antibody (NBP1-58045)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PCPE-1/PCOLCE Antibody (NBP1-58045) (0)

There are no reviews for PCPE-1/PCOLCE Antibody (NBP1-58045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCPE-1/PCOLCE Antibody (NBP1-58045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCPE-1/PCOLCE Products

Bioinformatics Tool for PCPE-1/PCOLCE Antibody (NBP1-58045)

Discover related pathways, diseases and genes to PCPE-1/PCOLCE Antibody (NBP1-58045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCPE-1/PCOLCE Antibody (NBP1-58045)

Discover more about diseases related to PCPE-1/PCOLCE Antibody (NBP1-58045).

Pathways for PCPE-1/PCOLCE Antibody (NBP1-58045)

View related products by pathway.

PTMs for PCPE-1/PCOLCE Antibody (NBP1-58045)

Learn more about PTMs related to PCPE-1/PCOLCE Antibody (NBP1-58045).

Blogs on PCPE-1/PCOLCE

There are no specific blogs for PCPE-1/PCOLCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCPE-1/PCOLCE Antibody and receive a gift card or discount.


Gene Symbol PCOLCE