PCPE-1/PCOLCE Antibody

Product Discontinued

PCPE-1/PCOLCE Antibody Summary

• Immunogen: Synthetic peptides corresponding to PCOLCE(procollagen C-endopeptidase enhancer) The peptide sequence was selected from the middle region of PCOLCE (NP_002584). Peptide sequence LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS.
• Predicted Species: Human (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCOLCE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25947382).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCPE-1/PCOLCE Antibody

• PCOLCE
• PCPE
• PCPE1
• PCPE-1
• PCPE1Type I procollagen COOH-terminal proteinase enhancer
• procollagen C-endopeptidase enhancer 1
• procollagen C-endopeptidase enhancer
• Procollagen COOH-terminal proteinase enhancer 1
• Procollagen C-proteinase enhancer 1
• procollagen, type 1, COOH-terminal proteinase enhancer
• Type 1 procollagen C-proteinase enhancer protein

Background

PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCPE-1/PCOLCE Antibody (NBP1-58045)(1)

Publication using NBP1-58045

• Pollard RD, Blesso CN, Zabalawi M et al. Procollagen C-Endopeptidase Enhancer Protein 2 (PCPE2) Reduces Atherosclerosis in Mice by Enhancing SR-BI Mediated HDL-Cholesteryl Ester Uptake. J. Biol. Chem. 2015-05-06 [PMID: 25947382] (WB, Mouse)

Bioinformatics

• Gene Symbol: PCOLCE
• Entrez:
  • 5118(Human)
• Uniprot:
  • Q15113()