PCPE-1/PCOLCE Antibody

Images

 
Western Blot: PCPE-1/PCOLCE Antibody [NBP1-58045] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

PCPE-1/PCOLCE Antibody Summary

Immunogen
Synthetic peptides corresponding to PCOLCE(procollagen C-endopeptidase enhancer) The peptide sequence was selected from the middle region of PCOLCE (NP_002584). Peptide sequence LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCOLCE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-58045 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCPE-1/PCOLCE Antibody

  • PCOLCE
  • PCPE
  • PCPE1
  • PCPE-1
  • PCPE1Type I procollagen COOH-terminal proteinase enhancer
  • procollagen C-endopeptidase enhancer 1
  • procollagen C-endopeptidase enhancer
  • Procollagen COOH-terminal proteinase enhancer 1
  • Procollagen C-proteinase enhancer 1
  • procollagen, type 1, COOH-terminal proteinase enhancer
  • Type 1 procollagen C-proteinase enhancer protein

Background

PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-58529
Species: Hu
Applications: ICC/IF
AF6278
Species: Hu, Mu
Applications: WB
AF7164
Species: Hu
Applications: WB
NBP1-80935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91612
Species: Mu
Applications: WB
NBP2-56288
Species: Hu
Applications: ICC/IF
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58045
Species: Hu
Applications: WB

Publications for PCPE-1/PCOLCE Antibody (NBP1-58045)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PCPE-1/PCOLCE Antibody (NBP1-58045) (0)

There are no reviews for PCPE-1/PCOLCE Antibody (NBP1-58045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCPE-1/PCOLCE Antibody (NBP1-58045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCPE-1/PCOLCE Products

Bioinformatics Tool for PCPE-1/PCOLCE Antibody (NBP1-58045)

Discover related pathways, diseases and genes to PCPE-1/PCOLCE Antibody (NBP1-58045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCPE-1/PCOLCE Antibody (NBP1-58045)

Discover more about diseases related to PCPE-1/PCOLCE Antibody (NBP1-58045).
 

Pathways for PCPE-1/PCOLCE Antibody (NBP1-58045)

View related products by pathway.

PTMs for PCPE-1/PCOLCE Antibody (NBP1-58045)

Learn more about PTMs related to PCPE-1/PCOLCE Antibody (NBP1-58045).

Blogs on PCPE-1/PCOLCE

There are no specific blogs for PCPE-1/PCOLCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCPE-1/PCOLCE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCOLCE
Entrez
Uniprot