New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » PCP4 » PCP4 Proteins » Recombinant Human PCP4 GST (N-Term) Protein

Recombinant Human PCP4 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human PCP4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-62 of Human PCP4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Functional
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
32.56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00005121-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCP4 GST (N-Term) Protein

  • brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
  • Brain-specific polypeptide PEP-19
  • PEP19
  • PEP-19
  • Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
Neurogranin
Antibody [Unconjugate
AF7947
Western blot shows lysates of mouse brain (cortex) tissue, human brain (motor cortex) tissue, and rat brain (cortex) tissue. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat Neurogranin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7947) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurogranin at approximately 14-16 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neurogranin was detected in perfusion fixed frozen sections of rat brain (hippocampus) using Sheep Anti-Human/Mouse/Rat Neurogranin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7947) at 0.5 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to pyramidal neurons in the hippocampus. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
TCF7L2 Antibody
(SC06-90)
NBP2-67618
Flow Cytometry: TCF7L2 Antibody (SC06-90) [NBP2-67618] - Analysis of Jurkat cells with TCF7L2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: TCF7L2 Antibody (SC06-90) [NBP2-67618] - Staining TCF7L2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: TCF7L2 Antibody (SC06-90) [NBP2-67618] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-TCF7L2 antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(81 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
PP14/Glycodelin
Antibody
NBP1-89781
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining in human endometrium and prostate tissues using anti-PAEP antibody. Corresponding PAEP RNA-seq data are presented for the same tissues.
Western Blot: PP14/Glycodelin Antibody [NBP1-89781] - Analysis in human placenta tissue.
Species: Hu
Applications: IHC, IHC-P, WB
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human duodenum shows no positivity in glandular cells as expected.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/Immunofluorescence: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody stainin is shown in green.
Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining of human pancreas shows low expression as expected.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Lyp/PTPN22
Antibody (340113)
MAB3428
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Daudi human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Lyp Monoclonal Antibody (Catalog # MAB3428) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Lyp at approximately 108 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lyp was detected in immersion fixed paraffin-embedded sections of human lymph node using 25 µg/mL Mouse Anti-Human Lyp Monoclonal Antibody (Catalog # MAB3428) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
LHX9 Antibody
NBP2-87727
Western Blot: LHX9 Antibody [NBP2-87727] - WB Suggested Anti-LHX9 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry: LHX9 Antibody [NBP2-87727] - Human Muscle
Species: Hu
Applications: IHC, IHC-P, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(81 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAO-A Antibody
(OTI2F10)
NBP2-01752
Immunohistochemistry-Paraffin: MAO-A Antibody (2F10) [NBP2-01752] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Monoamine Oxidase A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MAO-A Antibody (2F10) [NBP2-01752] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Monoamine Oxidase A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MAO-A Antibody (2F10) [NBP2-01752] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Monoamine Oxidase A mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAP2 Antibody
NB300-213
Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280 kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Human DA neurons 28 DIV stained with MAP2 antibody (blue). ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Immunofluorescent analysis of cortical neuron-glial cell culture from E20 rat stained with chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:10,000 in red, and mouse mAb to MAP-tau, NPB2-25162, dilution 1:2,000, in green. The blue is DAPI staining of nuclear DNA. NB300-213 antibody stains dendrites and perikarya of neurons, while NBP2-25162 antibody labels neuronal perikarya, dendrites and also axonal process. As a result perikarya and dendrites appears orange-yellow, since they contain both MAP2 and tau, while axons are green.
(5 Reviews)
(75 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
EDF1 Antibody
NBP2-92882
Immunohistochemistry-Paraffin: EDF1 Antibody [NBP2-92882] - Human gastric cancer using EDF1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: EDF1 Antibody [NBP2-92882] - Mouse lung using EDF1 antibody at dilution of 1:100 (40x lens).
Western Blot: EDF1 Antibody [NBP2-92882] - Analysis of extracts of various cell lines, using EDF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western blot shows 25 ng of Recombinant Human BMP‑1/PCP (Catalog # 1927-ZN), Recombinant Human TLL-2, Recombinant Human/Mouse/Rat BMP‑2 (Catalog # 355-BM), Recombinant Human BMP‑3 (Catalog # 113-BP), Recombinant Human BMP‑3b/GDF‑10 (Catalog # 1543-BP), Recombinant Human BMP‑4 (Catalog # 314-BP), Recombinant Human BMP‑5 (Catalog # 615-BMC), Recombinant Human BMP‑6 (Catalog # 507-BP), Recombinant Human BMP‑7 (Catalog # 354-BP), Recombinant Human BMP‑8a (Catalog # 1073-BP), Recombinant Human BMP‑8b (Catalog # 9316-BP), Recombinant Human BMP‑9 (Catalog # 3209-BP), Recombinant Human BMP‑10 (Catalog # 2926-BP) and Recombinant Human BMP‑15/GDF‑9B (Catalog # 5096-BM) . PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human BMP‑1/PCP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1927) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BMP‑1/PCP at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Western blot shows 25 ng of Recombinant Human BMP‑1/PCP (Catalog # 1927-ZN), Recombinant Human TLL-2, Recombinant Human Meprin  alpha  Subunit/MEP1A (Catalog # 3220-ZN), Recombinant Human Meprin  beta Subunit/MEP1B (Catalog # 2895-ZN), Recombinant Human Ovastacin, Recombinant Human ADAM10 (Catalog # 936-AD), Recombinant Human ADAMTS4 (Catalog # 4307-AD), and Recombinant Human MMP‑1 (Catalog # 901-MP). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human BMP‑1/PCP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1927) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BMP‑1/PCP at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(6 Publications)
Species: Hu
Applications: IP, WB
SLC7A7 Antibody
NBP1-82826
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human prostate shows low expression as expected.
Western Blot: SLC7A7 Antibody [NBP1-82826] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu
Applications: IHC, IHC-P, WB

Publications for PCP4 Partial Recombinant Protein (H00005121-Q01)(1)


Reviews for PCP4 Partial Recombinant Protein (H00005121-Q01) (0)

There are no reviews for PCP4 Partial Recombinant Protein (H00005121-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCP4 Partial Recombinant Protein (H00005121-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCP4 Products

Bioinformatics Tool for PCP4 Partial Recombinant Protein (H00005121-Q01)

Discover related pathways, diseases and genes to PCP4 Partial Recombinant Protein (H00005121-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCP4 Partial Recombinant Protein (H00005121-Q01)

Discover more about diseases related to PCP4 Partial Recombinant Protein (H00005121-Q01).
 

Pathways for PCP4 Partial Recombinant Protein (H00005121-Q01)

View related products by pathway.

PTMs for PCP4 Partial Recombinant Protein (H00005121-Q01)

Learn more about PTMs related to PCP4 Partial Recombinant Protein (H00005121-Q01).

Blogs on PCP4.

Check out the latest blog posts on PCP4.
RNA-binding protein Staufen1 conspires with Atxn2 in stress granules to cause neurodegeneration by dysregulating RNA metabolism
By Jamshed Arslan Pharm.D. Spinocerebellar ataxia type 2 (SCA2) is a movement disorder characterized by neurodegeneration. The cause of this autosomal dominant disease is a mutation in the RNA processing gene Atxn2,...  Read full blog post.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
GAP-43 Antibody
NB300-143
Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280 kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.
MAP2 Antibody
NB300-213

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCP4 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PCP4