Recombinant Human PCP4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCP4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 62 of Human PCP4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCP4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00005121-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCP4 Protein

  • brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
  • Brain-specific polypeptide PEP-19
  • PEP19
  • PEP-19
  • Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF842
Species: Hu
Applications: WB
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84011
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
H00009056-B01P
Species: Hu, Rt
Applications: WB

Publications for PCP4 Partial Recombinant Protein (H00005121-Q01)(1)


Reviews for PCP4 Partial Recombinant Protein (H00005121-Q01) (0)

There are no reviews for PCP4 Partial Recombinant Protein (H00005121-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCP4 Partial Recombinant Protein (H00005121-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCP4 Products

Bioinformatics Tool for PCP4 Partial Recombinant Protein (H00005121-Q01)

Discover related pathways, diseases and genes to PCP4 Partial Recombinant Protein (H00005121-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCP4 Partial Recombinant Protein (H00005121-Q01)

Discover more about diseases related to PCP4 Partial Recombinant Protein (H00005121-Q01).
 

Pathways for PCP4 Partial Recombinant Protein (H00005121-Q01)

View related products by pathway.

PTMs for PCP4 Partial Recombinant Protein (H00005121-Q01)

Learn more about PTMs related to PCP4 Partial Recombinant Protein (H00005121-Q01).

Blogs on PCP4

There are no specific blogs for PCP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GAP-43 Antibody
NB300-143
PCP4 Antibody
NBP1-80929
MAP2 Antibody
NB300-213

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCP4