PCP4 Antibody (1E3) - Azide and BSA Free

ELISA: PCP4 Antibody (1E3) [H00005121-M14] - Detection limit for recombinant GST tagged PCP4 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCP4 Antibody (1E3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
• Specificity: PCP4 - Purkinje cell protein 4 (1E3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCP4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCP4 Antibody (1E3) - Azide and BSA Free

• brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
• Brain-specific polypeptide PEP-19
• PEP19
• PEP-19
• Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCP4
• Entrez:
  • 5121(Human)
• Uniprot:
  • NP_006189(Human)