PCK1 Antibody

Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry-Paraffin: PCK1 Antibody [NBP1-54825] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Brain Lysate, concentration 1.0ug/ml.

Western Blot: PCK1 Antibody [NBP1-54825] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: PCK1 Antibody [NBP1-54825] - MCF7, Antibody Dilution: 1.0 ug/ml.

Product Discontinued

PCK1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble)) The peptide sequence was selected from the middle region of PCK1. Peptide sequence NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCK1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 4.0-8.0 ug/ml
  • Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PCK1 and was validated on Western Blot and immunohistochemistry-P
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCK1 Antibody

• EC 4.1.1.32
• MGC22652
• PCK1
• PEPCK1
• PEPCKC
• PEPCK-C
• PEPCK-CPEP carboxykinase
• phosphoenolpyruvate carboxykinase 1 (soluble)
• phosphoenolpyruvate carboxykinase, cytosolic [GTP]
• phosphoenolpyruvate carboxykinase, cytosolic
• Phosphoenolpyruvate carboxylase
• phosphopyruvate carboxylase

Background

PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCK1 Antibody (NBP1-54825)(2)

Publications using NBP1-54825

• Saini N, Mooney SM, Smith SM Alcohol blunts pregnancy-mediated insulin resistance and reduces fetal brain glucose despite elevated fetal gluconeogenesis, and these changes associate with fetal weight outcomes FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2023-10-01 [PMID: 37665328]
• Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat Med 2014-11-01 [PMID: 25282357] (WB)

Bioinformatics

• Gene Symbol: PCK1
• Uniprot:
  • P35558(Human)