PCK1 Antibody


Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: PCK1 Antibody [NBP1-54825] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Brain Lysate, concentration 1.0ug/ml.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: PCK1 Antibody [NBP1-54825] - MCF7, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PCK1 Antibody Summary

Synthetic peptides corresponding to PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble)) The peptide sequence was selected from the middle region of PCK1. Peptide sequence NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 4.0-8.0 ug/ml
  • Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PCK1 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-54825.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCK1 Antibody

  • EC
  • MGC22652
  • PCK1
  • PEPCK1
  • PEPCK-CPEP carboxykinase
  • phosphoenolpyruvate carboxykinase 1 (soluble)
  • phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  • phosphoenolpyruvate carboxykinase, cytosolic
  • Phosphoenolpyruvate carboxylase
  • phosphopyruvate carboxylase


PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PCK1 Antibody (NBP1-54825)(1)

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PCK1 Antibody (NBP1-54825) (0)

There are no reviews for PCK1 Antibody (NBP1-54825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCK1 Antibody (NBP1-54825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PCK1 Antibody (NBP1-54825)

Discover related pathways, diseases and genes to PCK1 Antibody (NBP1-54825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCK1 Antibody (NBP1-54825)

Discover more about diseases related to PCK1 Antibody (NBP1-54825).

Pathways for PCK1 Antibody (NBP1-54825)

View related products by pathway.

PTMs for PCK1 Antibody (NBP1-54825)

Learn more about PTMs related to PCK1 Antibody (NBP1-54825).

Blogs on PCK1

There are no specific blogs for PCK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCK1 Antibody and receive a gift card or discount.


Gene Symbol PCK1