Reactivity | Hu, Mu, Rt, Po, Bv, Ca, EqSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble)) The peptide sequence was selected from the middle region of PCK1. Peptide sequence NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Porcine (93%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PCK1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against PCK1 and was validated on Western Blot and immunohistochemistry-P |
|
Theoretical MW | 69 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Protein A purified |
Publication using NBP1-54825 | Applications | Species |
---|---|---|
Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat. Med. 2014 Oct 05 [PMID: 25282357] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Diseases for PCK1 Antibody (NBP1-54825)Discover more about diseases related to PCK1 Antibody (NBP1-54825).
| Pathways for PCK1 Antibody (NBP1-54825)View related products by pathway.
|
PTMs for PCK1 Antibody (NBP1-54825)Learn more about PTMs related to PCK1 Antibody (NBP1-54825).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.