Recombinant Human PCDHGB6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCDHGB6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 162-269 of Human PCDHGB6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ININSIKDYKINSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENLPPGSPVLQVTATDQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHGB6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCDHGB6 Protein

  • PCDH-GAMMA-B6
  • protocadherin gamma subfamily B, 6
  • protocadherin gamma-B6

Background

PCDHGB6 - protocadherin gamma subfamily B, 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-06677
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
MAB7876
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-02978
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF844
Species: Mu
Applications: WB, Block
NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA

Publications for PCDHGB6 Partial Recombinant Protein (H00056100-Q01) (0)

There are no publications for PCDHGB6 Partial Recombinant Protein (H00056100-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHGB6 Partial Recombinant Protein (H00056100-Q01) (0)

There are no reviews for PCDHGB6 Partial Recombinant Protein (H00056100-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHGB6 Partial Recombinant Protein (H00056100-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCDHGB6 Products

Bioinformatics Tool for PCDHGB6 Partial Recombinant Protein (H00056100-Q01)

Discover related pathways, diseases and genes to PCDHGB6 Partial Recombinant Protein (H00056100-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHGB6 Partial Recombinant Protein (H00056100-Q01)

Discover more about diseases related to PCDHGB6 Partial Recombinant Protein (H00056100-Q01).
 

Pathways for PCDHGB6 Partial Recombinant Protein (H00056100-Q01)

View related products by pathway.

PTMs for PCDHGB6 Partial Recombinant Protein (H00056100-Q01)

Learn more about PTMs related to PCDHGB6 Partial Recombinant Protein (H00056100-Q01).

Blogs on PCDHGB6

There are no specific blogs for PCDHGB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
PCDHGB6 RNAi
H00056100-R02-20nmol
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCDHGB6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHGB6