Recombinant Human PCDHA6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCDHA6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 295-370 of Human PCDHA6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVREDAQFGTVIA

Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHA6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCDHA6 Protein

  • CNR2
  • CNRN2
  • CNRS2
  • CRNR2
  • KIAA0345-like 8
  • PCDH-ALPHA6
  • PCDH-alpha-6
  • protocadherin alpha 6
  • protocadherin alpha-6

Background

PCDHA6 - protocadherin alpha 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-12553
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00056142-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PCDHA6 Partial Recombinant Protein (H00056142-Q01) (0)

There are no publications for PCDHA6 Partial Recombinant Protein (H00056142-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHA6 Partial Recombinant Protein (H00056142-Q01) (0)

There are no reviews for PCDHA6 Partial Recombinant Protein (H00056142-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHA6 Partial Recombinant Protein (H00056142-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCDHA6 Products

Bioinformatics Tool for PCDHA6 Partial Recombinant Protein (H00056142-Q01)

Discover related pathways, diseases and genes to PCDHA6 Partial Recombinant Protein (H00056142-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHA6 Partial Recombinant Protein (H00056142-Q01)

Discover more about diseases related to PCDHA6 Partial Recombinant Protein (H00056142-Q01).
 

Pathways for PCDHA6 Partial Recombinant Protein (H00056142-Q01)

View related products by pathway.

Blogs on PCDHA6

There are no specific blogs for PCDHA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCDHA6 Antibody
NBP2-57234

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCDHA6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHA6