PCDH7 Antibody - BSA Free

Immunohistochemistry-Paraffin: PCDH7 Antibody [NBP1-88610] - Staining of human Fallopian tube shows weak to moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PCDH7 Antibody [NBP1-88610] - Staining of human colon shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PCDH7 Antibody [NBP1-88610] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: PCDH7 Antibody [NBP1-88610] - Staining of human stomach shows strong membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCDH7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCDH7 Antibody - BSA Free (NBP1-88610) is a polyclonal antibody validated for use in IHC and WB. Anti-PCDH7 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDH7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot Reported in scientific literature (PMID: 25494202)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 116 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  PCDH7 Protein (NBP1-88610PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCDH7 Antibody - BSA Free

• BH-PcdhBHPCDHprotocadherin-7
• BH-protocadherin (brain-heart)
• Brain-heart protocadherin
• protocadherin 7

Background

The PCDH7 gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a proteinwith an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that isthought to function

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCDH7 Antibody (NBP1-88610)(2)

Publications using NBP1-88610

• Konermann S, Brigham MD, Trevino AE et al. Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature 2015-01-29 [PMID: 25494202] (WB, Human)
• Beggs AD, Jones A, Shepherd N et al. Loss of Expression and Promoter Methylation of SLIT2 Are Associated with Sessile Serrated Adenoma Formation. PLoS Genet 2013-05-01 [PMID: 23671423]

FAQs for PCDH7 Antibody (NBP1-88610). (Showing 1 - 1 of 1 FAQs).

1. I've ordered recently your antibody for Protocadherin-7 (NBP1-88610). I would like to ask if you could give me the average concentration? In the process of aliquoting, I forgot to write down the concentration of the stock. I would like to use it for immunofluorescent which recommends a concentration between 1-4 ug/ml.
   • The concentration of our latest lot of NBP1-88610 is 0.2 mg/ml.

Bioinformatics

• Gene Symbol: PCDH7
• Entrez:
  • 5099(Human)
• Uniprot:
  • O60245(Human)