PCBD2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PCBD2 Antibody - BSA Free (NBP2-88016) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of PCBD2. Peptide sequence: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PCBD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PCBD2 Antibody - BSA Free
Background
PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for PCBD2 Antibody (NBP2-88016) (0)
There are no publications for PCBD2 Antibody (NBP2-88016).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCBD2 Antibody (NBP2-88016) (0)
There are no reviews for PCBD2 Antibody (NBP2-88016).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCBD2 Antibody (NBP2-88016) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCBD2 Products
Blogs on PCBD2