PCBD2 Antibody - Azide and BSA Free

Western Blot: PCBD2 Antibody [H00084105-B01P] - Analysis of PCBD2 expression in transfected 293T cell line by PCBD2 polyclonal antibody. Lane 1: PCBD2 transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCBD2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PCBD2 Antibody - Azide and BSA Free (H00084105-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PCBD2 (NP_115527.2, 1 a.a. - 129 a.a.) full-length human protein. MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV
• Specificity: PCBD2 - pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PCBD2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCBD2 Antibody - Azide and BSA Free

• 4-alpha-hydroxy-tetrahydropterin dehydratase 2
• DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• DcoH-like protein DCoHm
• dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle
• dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)
• Dimerization cofactor of hepatocyte nuclear factor 1 from muscle
• EC 4.2.1.96
• HNF-1-alpha dimerization cofactor
• PHS 2
• pterin-4 alpha-carbinolamine dehydratase 2
• pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• pterin-4-alpha-carbinolamine dehydratase 2

Background

PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCBD2
• Entrez:
  • 84105(Human)
• Uniprot:
  • NP_115527.2(Human)