PCBD2 Antibody - Azide and BSA Free Summary
| Immunogen |
PCBD2 (NP_115527.2, 1 a.a. - 129 a.a.) full-length human protein. MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV |
| Specificity |
PCBD2 - pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
PCBD2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PCBD2 Antibody - Azide and BSA Free
Background
PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for PCBD2 Antibody (H00084105-B01P) (0)
There are no publications for PCBD2 Antibody (H00084105-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCBD2 Antibody (H00084105-B01P) (0)
There are no reviews for PCBD2 Antibody (H00084105-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCBD2 Antibody (H00084105-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCBD2 Products
Blogs on PCBD2