PBK Antibody (3F7)

Images

 
Western Blot: PBK Antibody (3F7) [H00055872-M04] - Analysis of PBK expression in Raw 264.7 (Cat # L024V1).
Western Blot: PBK Antibody (3F7) [H00055872-M04] - Analysis of PBK expression in HeLa (Cat # L013V1).
Western Blot: PBK Antibody (3F7) [H00055872-M04] - Analysis of PBK expression in PC-12 (Cat # L012V1).
Western Blot: PBK Antibody (3F7) [H00055872-M04] - Analysis of PBK expression in NIH/3T3 (Cat # L018V1).
ELISA: PBK Antibody (3F7) [H00055872-M04] - Detection limit for recombinant GST tagged PBK is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
3F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PBK Antibody (3F7) Summary

Immunogen
PBK (AAH15191, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Specificity
PBK - PDZ binding kinase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PBK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBK Antibody (3F7)

  • Cancer/testis antigen 84
  • CT84MAPKK-like protein kinase
  • EC 2.7.12.2
  • FLJ14385
  • Nori-3PDZ-binding kinase
  • PDZ binding kinase
  • serine/threonine protein kinase
  • Spermatogenesis-related protein kinase
  • SPKT-LAK cell-originated protein kinase
  • TOPKlymphokine-activated killer T-cell-originated protein kinase

Background

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF2460
Species: Hu
Applications: IP, Neut, WB
NBP3-09949
Species: Hu
Applications: WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
H00055872-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for PBK Antibody (H00055872-M04) (0)

There are no publications for PBK Antibody (H00055872-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBK Antibody (H00055872-M04) (0)

There are no reviews for PBK Antibody (H00055872-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBK Antibody (H00055872-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBK Products

Bioinformatics Tool for PBK Antibody (H00055872-M04)

Discover related pathways, diseases and genes to PBK Antibody (H00055872-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBK Antibody (H00055872-M04)

Discover more about diseases related to PBK Antibody (H00055872-M04).
 

Pathways for PBK Antibody (H00055872-M04)

View related products by pathway.

PTMs for PBK Antibody (H00055872-M04)

Learn more about PTMs related to PBK Antibody (H00055872-M04).
 

Research Areas for PBK Antibody (H00055872-M04)

Find related products by research area.

Blogs on PBK

There are no specific blogs for PBK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBK Antibody (3F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PBK
Entrez
Uniprot