Recombinant Human Pax5/BSAP GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Pax5/BSAP Peptides and Proteins

Order Details


    • Catalog Number
      H00005079-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Pax5/BSAP GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-391 of Human PAX5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PAX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
68.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pax5/BSAP GST (N-Term) Protein

  • B cell specific activator protein
  • B-cell-specific transcription factor
  • BSAP
  • BSAPB-cell lineage specific activator
  • paired box 5
  • paired box gene 5 (B-cell lineage specific activator protein)
  • paired box gene 5 (B-cell lineage specific activator)
  • paired box homeotic gene 5
  • paired box protein Pax-5
  • Pax5
  • transcription factor PAX 5

Background

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB7650
Species: Mu
Applications: IHC, WB
NB100-64347
Species: Hu
Applications: Flow, IHC, IHC-Fr,  IHC-P
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
207-IL
Species: Hu
Applications: BA
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP2-75734
Species: Hu
Applications: ELISA, IHC,  IHC-P, PA, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
H00005079-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Pax5/BSAP Recombinant Protein (H00005079-P01) (0)

There are no publications for Pax5/BSAP Recombinant Protein (H00005079-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax5/BSAP Recombinant Protein (H00005079-P01) (0)

There are no reviews for Pax5/BSAP Recombinant Protein (H00005079-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax5/BSAP Recombinant Protein (H00005079-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pax5/BSAP Products

Research Areas for Pax5/BSAP Recombinant Protein (H00005079-P01)

Find related products by research area.

Blogs on Pax5/BSAP

There are no specific blogs for Pax5/BSAP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pax5/BSAP GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX5