Pax5/BSAP Recombinant Protein Antigen

Images

 
There are currently no images for Pax5/BSAP Protein (NBP2-38790PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pax5/BSAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAX5.

Source: E. coli

Amino Acid Sequence: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38790.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pax5/BSAP Recombinant Protein Antigen

  • B cell specific activator protein
  • B-cell-specific transcription factor
  • BSAP
  • BSAPB-cell lineage specific activator
  • paired box 5
  • paired box gene 5 (B-cell lineage specific activator protein)
  • paired box gene 5 (B-cell lineage specific activator)
  • paired box homeotic gene 5
  • paired box protein Pax-5
  • Pax5
  • transcription factor PAX 5

Background

PAX5 encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB7650
Species: Mu
Applications: IHC, WB
NBP2-44738
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
NBP2-75738
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
207-IL
Species: Hu
Applications: BA
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP2-75734
Species: Hu
Applications: ELISA, IHC,  IHC-P, PA, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-38790PEP
Species: Hu
Applications: AC

Publications for Pax5/BSAP Protein (NBP2-38790PEP) (0)

There are no publications for Pax5/BSAP Protein (NBP2-38790PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax5/BSAP Protein (NBP2-38790PEP) (0)

There are no reviews for Pax5/BSAP Protein (NBP2-38790PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pax5/BSAP Protein (NBP2-38790PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pax5/BSAP Products

Research Areas for Pax5/BSAP Protein (NBP2-38790PEP)

Find related products by research area.

Blogs on Pax5/BSAP

There are no specific blogs for Pax5/BSAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pax5/BSAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX5