Pax5/BSAP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAX5. Source: E. coli
Amino Acid Sequence: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PAX5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Pax5/BSAP Recombinant Protein Antigen
Background
PAX5 encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: AC
Publications for Pax5/BSAP Protein (NBP2-38790PEP) (0)
There are no publications for Pax5/BSAP Protein (NBP2-38790PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pax5/BSAP Protein (NBP2-38790PEP) (0)
There are no reviews for Pax5/BSAP Protein (NBP2-38790PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Pax5/BSAP Protein (NBP2-38790PEP) (0)
Additional Pax5/BSAP Products
Research Areas for Pax5/BSAP Protein (NBP2-38790PEP)
Find related products by research area.
|
Blogs on Pax5/BSAP