PATJ Antibody [DyLight 650]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

PATJ Antibody [DyLight 650] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-680 of human PATJ (NP_795352.2).
  
  Sequence:
  MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INADL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for PATJ Antibody [DyLight 650]

• channel-interacting PDZ domain protein
• FLJ26982
• hINADL
• inactivation no after-potential D-like protein
• Inadl protein
• InaD-like (Drosophila)
• inaD-like protein
• InaD-like
• Pals1-associated tight junction protein
• PATJCipp
• PDZ domain protein
• Protein associated to tight junctions

Background

The PATJ gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INADL