Recombinant Human Patched 1/PTCH GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Patched 1/PTCH Protein [H00005727-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Patched 1/PTCH Peptides and Proteins

Order Details


    • Catalog Number
      H00005727-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Patched 1/PTCH GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-183 of Human PTCH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PTCH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
47.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Patched 1/PTCH GST (N-Term) Protein

  • BCNS
  • BCNSFLJ42602
  • FLJ26746
  • HPE7
  • mes
  • NBCCS
  • patched (Drosophila) homolog
  • Patched 1
  • patched homolog (Drosophila)
  • patched homolog 1 (Drosophila)
  • patched homolog 1
  • protein patched homolog 1
  • PTC
  • ptc1
  • PTCH protein +12b
  • PTCH protein +4'
  • PTCH protein -10
  • PTCH
  • PTCH1
  • PTCH11

Background

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: IHC, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
H00008031-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
AF4078
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF3635
Species: Mu
Applications: IHC, WB
AF1056
Species: Rt
Applications: IHC, WB
314-BP
Species: Hu
Applications: BA, BA
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
H00005727-P01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Patched 1/PTCH Recombinant Protein (H00005727-P01) (0)

There are no publications for Patched 1/PTCH Recombinant Protein (H00005727-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 1/PTCH Recombinant Protein (H00005727-P01) (0)

There are no reviews for Patched 1/PTCH Recombinant Protein (H00005727-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Patched 1/PTCH Recombinant Protein (H00005727-P01). (Showing 1 - 1 of 1 FAQ).

  1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
    • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Additional Patched 1/PTCH Products

Research Areas for Patched 1/PTCH Recombinant Protein (H00005727-P01)

Find related products by research area.

Blogs on Patched 1/PTCH

There are no specific blogs for Patched 1/PTCH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Patched 1/PTCH GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH1