Recombinant Human Patched 1/PTCH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Patched 1/PTCH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-183 of Human PTCH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLL

Protein/Peptide Type
Recombinant Protein
Gene
PTCH1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Patched 1/PTCH Protein

  • BCNS
  • BCNSFLJ42602
  • FLJ26746
  • HPE7
  • mes
  • NBCCS
  • patched (Drosophila) homolog
  • Patched 1
  • patched homolog (Drosophila)
  • patched homolog 1 (Drosophila)
  • patched homolog 1
  • protein patched homolog 1
  • PTC
  • ptc1
  • PTCH protein +12b
  • PTCH protein +4'
  • PTCH protein -10
  • PTCH
  • PTCH1
  • PTCH11

Background

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB200-119
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for Patched 1/PTCH Recombinant Protein (H00005727-P01) (0)

There are no publications for Patched 1/PTCH Recombinant Protein (H00005727-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 1/PTCH Recombinant Protein (H00005727-P01) (0)

There are no reviews for Patched 1/PTCH Recombinant Protein (H00005727-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Patched 1/PTCH Recombinant Protein (H00005727-P01). (Showing 1 - 1 of 1 FAQ).

  1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
    • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Additional Patched 1/PTCH Products

Bioinformatics Tool for Patched 1/PTCH Recombinant Protein (H00005727-P01)

Discover related pathways, diseases and genes to Patched 1/PTCH Recombinant Protein (H00005727-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Patched 1/PTCH Recombinant Protein (H00005727-P01)

Discover more about diseases related to Patched 1/PTCH Recombinant Protein (H00005727-P01).
 

Pathways for Patched 1/PTCH Recombinant Protein (H00005727-P01)

View related products by pathway.

PTMs for Patched 1/PTCH Recombinant Protein (H00005727-P01)

Learn more about PTMs related to Patched 1/PTCH Recombinant Protein (H00005727-P01).
 

Research Areas for Patched 1/PTCH Recombinant Protein (H00005727-P01)

Find related products by research area.

Blogs on Patched 1/PTCH

There are no specific blogs for Patched 1/PTCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Patched 1/PTCH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH1
Entrez