Patched 1/PTCH Recombinant Protein Antigen

Images

 
There are currently no images for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Patched 1/PTCH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Patched 1/PTCH.

Source: E. coli

Amino Acid Sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTCH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57927.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Patched 1/PTCH Recombinant Protein Antigen

  • BCNS
  • BCNSFLJ42602
  • FLJ26746
  • HPE7
  • mes
  • NBCCS
  • patched (Drosophila) homolog
  • Patched 1
  • patched homolog (Drosophila)
  • patched homolog 1 (Drosophila)
  • patched homolog 1
  • protein patched homolog 1
  • PTC
  • ptc1
  • PTCH protein +12b
  • PTCH protein +4'
  • PTCH protein -10
  • PTCH
  • PTCH1
  • PTCH11

Background

Mutations of the human Patched tumor suppressor gene (PTCH) have been identified in individuals with the nevoid basal cell carcinoma syndrome (NBCCS) as well as in sporadic basal cell carcinomas and medulloblastomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: IHC, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
H00008031-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
AF4078
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF3635
Species: Mu
Applications: IHC, WB
AF1056
Species: Rt
Applications: IHC, WB
314-BP
Species: Hu
Applications: BA, BA
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP2-57927PEP
Species: Hu
Applications: AC

Publications for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP) (0)

There are no publications for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP) (0)

There are no reviews for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP). (Showing 1 - 1 of 1 FAQ).

  1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
    • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Additional Patched 1/PTCH Products

Research Areas for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Find related products by research area.

Blogs on Patched 1/PTCH

There are no specific blogs for Patched 1/PTCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Patched 1/PTCH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH1