Patched 1/PTCH Recombinant Protein Antigen

Images

 
There are currently no images for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Patched 1/PTCH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Patched 1/PTCH.

Source: E.coli

Amino Acid Sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTCH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57927 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Patched 1/PTCH Recombinant Protein Antigen

  • BCNS
  • BCNSFLJ42602
  • FLJ26746
  • HPE7
  • mes
  • NBCCS
  • patched (Drosophila) homolog
  • Patched 1
  • patched homolog (Drosophila)
  • patched homolog 1 (Drosophila)
  • patched homolog 1
  • protein patched homolog 1
  • PTC
  • ptc1
  • PTCH protein +12b
  • PTCH protein +4'
  • PTCH protein -10
  • PTCH
  • PTCH1
  • PTCH11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP) (0)

There are no publications for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP) (0)

There are no reviews for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP). (Showing 1 - 1 of 1 FAQ).

  1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
    • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Additional Patched 1/PTCH Products

Bioinformatics Tool for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Discover related pathways, diseases and genes to Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Discover more about diseases related to Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).
 

Pathways for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

View related products by pathway.

PTMs for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Learn more about PTMs related to Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP).
 

Research Areas for Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Find related products by research area.

Blogs on Patched 1/PTCH

There are no specific blogs for Patched 1/PTCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Patched 1/PTCH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH1
Entrez