Recombinant Human PARN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PARN Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 639 of Human PARN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW

Protein/Peptide Type
Recombinant Protein
Gene
PARN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARN Protein

  • DANEC 3.1.13.4
  • Deadenylating nuclease
  • Deadenylation nuclease
  • poly(A)-specific ribonuclease (deadenylation nuclease)
  • poly(A)-specific ribonuclease PARN
  • Polyadenylate-specific ribonuclease

Background

PARN( AAH50029, 1 a.a. - 640 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1075
Species: Hu
Applications: WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
355-BM/CF
Species: Hu, Mu, Rt
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005073-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PARN Recombinant Protein (H00005073-P01) (0)

There are no publications for PARN Recombinant Protein (H00005073-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARN Recombinant Protein (H00005073-P01) (0)

There are no reviews for PARN Recombinant Protein (H00005073-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARN Recombinant Protein (H00005073-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PARN Products

Bioinformatics Tool for PARN Recombinant Protein (H00005073-P01)

Discover related pathways, diseases and genes to PARN Recombinant Protein (H00005073-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARN Recombinant Protein (H00005073-P01)

Discover more about diseases related to PARN Recombinant Protein (H00005073-P01).
 

Pathways for PARN Recombinant Protein (H00005073-P01)

View related products by pathway.

PTMs for PARN Recombinant Protein (H00005073-P01)

Learn more about PTMs related to PARN Recombinant Protein (H00005073-P01).

Blogs on PARN

There are no specific blogs for PARN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PARN Antibody
H00005073-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PARN