PAQR5 Antibody (1F4) - Azide and BSA Free

Western Blot: PAQR5 Antibody (1F4) [H00054852-M01] - Detection against Immunogen (31.61 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PAQR5 Antibody (1F4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PAQR5 Antibody (1F4) - Azide and BSA Free (H00054852-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PAQR5 (NP_060175, 1 a.a. ~ 51 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGVAAAREECLVSGLPVLSPRPVHWTPETLGTQDTIGETGHFTKDLTGM*
• Specificity: PAQR5 (1F4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PAQR5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAQR5 Antibody (1F4) - Azide and BSA Free

• membrane progestin receptor gamma
• MPRGFLJ20190
• Progestin and adipoQ receptor family member 5
• progestin and adipoQ receptor family member VmPR gamma

Background

The steroid progesterone induces the resumption of maturation in oocytes via a nongenomic pathway through binding to a novel, membrane progestin receptor (mPR). This pathway inhibits adenylyl cyclase and reduces intracellular cAMP, and also activates mitogen-activated protein kinase to effect signal transduction pathways. Three distinct groups, designated alpha, beta, and gamma, comprise this gene family. While all contain 7 transmembrane domains, they show distinct distributions in reproductive, neural, kidney and intestinal tissues. These characteristics separate them from nuclear progestin receptors, and instead imply similarity to G-protein coupled receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAQR5
• Entrez:
  • 54852(Human)
• OMIM:
  • 607781(Human)
• Uniprot:
  • NP_060175(Human)