PANK2 Antibody (2B12) - Azide and BSA Free

Immunohistochemistry-Paraffin: PANK2 Antibody (2B12) [H00080025-M01] - Analysis of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. Antibody concentration 1 ~ 10 ug/ml.

Sandwich ELISA: PANK2 Antibody (2B12) [H00080025-M01] - Detection limit for recombinant GST tagged PANK2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PANK2 Antibody (2B12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PANK2 Antibody (2B12) - Azide and BSA Free (H00080025-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PANK2 (NP_705902, 205 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP
• Specificity: PANK2 - pantothenate kinase 2 (Hallervorden-Spatz syndrome)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PANK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PANK2 Antibody (2B12) - Azide and BSA Free

• C20orf48
• EC 2.7.1.33
• FLJ11729
• FLJ17232
• Hallervorden-Spatz syndrome
• HARPFLJ11729
• HPANK2
• HSS
• MGC15053
• NBIA1
• PANK2
• pantothenate kinase 2
• pantothenate kinase 2, mitochondrial
• Pantothenic acid kinase 2
• PKAN
• PKANneurodegeneration with brain iron accumulation 1 (Hallervorden-Spatz syndrome)

Background

This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PANK2
• Entrez:
  • 80025(Human)
• OMIM:
  • 234200(Human)
• Uniprot:
  • NP_705902(Human)