Recombinant Human Pancreatic Amylase Beta Protein

Images

 
SDS-Page: Recombinant Human Pancreatic Amylase Beta Protein [H00000280-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pancreatic Amylase Beta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-511 of Human AMY2B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AMY2B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pancreatic Amylase Beta Protein

  • alpha-amylase 2B
  • AMY2
  • AMY2B amylase, alpha 2B (pancreatic)

Background

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46713
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4636
Species: Mu
Applications: WB
AF4317
Species: Hu
Applications: WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00000280-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02) (0)

There are no publications for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02) (0)

There are no reviews for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pancreatic Amylase Beta Products

Bioinformatics Tool for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02)

Discover related pathways, diseases and genes to Pancreatic Amylase Beta Recombinant Protein (H00000280-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02)

Discover more about diseases related to Pancreatic Amylase Beta Recombinant Protein (H00000280-P02).
 

Pathways for Pancreatic Amylase Beta Recombinant Protein (H00000280-P02)

View related products by pathway.

Blogs on Pancreatic Amylase Beta

There are no specific blogs for Pancreatic Amylase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pancreatic Amylase Beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AMY2B