Recombinant Human Palladin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Palladin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 775-839 of Human KIAA0992 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PALLD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, 0.1M NaCl, pH 8.0, 10% glycerol, 1 mM dithiothreitol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Palladin Protein

  • CGI151
  • CGI-151
  • FLJ22190
  • FLJ38193
  • KIAA0992FLJ39139
  • MYN
  • myoneurin
  • Palladin
  • palladin, cytoskeletal associated protein
  • PALLD
  • PNCA1
  • Sarcoma antigen NY-SAR-77
  • SIH002
  • SIH002FLJ61376

Background

PALLD - palladin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00084665-M04
Species: Hu
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-05027
Species: Hu
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
H00441933-R02
Species: Hu
H00009124-D01P
Species: Hu
Applications: WB, ELISA
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89932
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Palladin Partial Recombinant Protein (H00023022-Q01) (0)

There are no publications for Palladin Partial Recombinant Protein (H00023022-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Palladin Partial Recombinant Protein (H00023022-Q01) (0)

There are no reviews for Palladin Partial Recombinant Protein (H00023022-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Palladin Partial Recombinant Protein (H00023022-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Palladin Products

Bioinformatics Tool for Palladin Partial Recombinant Protein (H00023022-Q01)

Discover related pathways, diseases and genes to Palladin Partial Recombinant Protein (H00023022-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Palladin Partial Recombinant Protein (H00023022-Q01)

Discover more about diseases related to Palladin Partial Recombinant Protein (H00023022-Q01).
 

Pathways for Palladin Partial Recombinant Protein (H00023022-Q01)

View related products by pathway.

Blogs on Palladin

There are no specific blogs for Palladin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Palladin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PALLD
Entrez