PAG608 Antibody

Immunohistochemistry-Paraffin: PAG608 Antibody [NBP2-62599] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PAG608 Antibody [NBP2-62599] - Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ZMAT3 antibody. Corresponding ZMAT3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PAG608 Antibody [NBP2-62599] - Staining of human tonsil shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PAG608 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZMAT3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PAG608 Antibody

• FLJ31683
• p53-activated gene 608 protein
• WIG1matrin type 3
• zinc finger, matrin-type 3

Background

PAG608 encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMAT3