PADI6 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PADI6. Peptide sequence: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PADI6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PADI6 Antibody - BSA Free
Background
Peptidylarginine deiminases (PADs, EC 3.5.3.15), including PADI6, make up a family of posttranslational proteinmodification enzymes that convert arginine residues to citrulline residues in the presence of calcium ions.(suppliedby OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Publications for PADI6 Antibody (NBP2-84207) (0)
There are no publications for PADI6 Antibody (NBP2-84207).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PADI6 Antibody (NBP2-84207) (0)
There are no reviews for PADI6 Antibody (NBP2-84207).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PADI6 Antibody (NBP2-84207) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PADI6 Products
Blogs on PADI6