PACT Recombinant Protein Antigen

Images

 
There are currently no images for PACT Recombinant Protein Antigen (NBP2-55124PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PACT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to PACT.

Source: E. coli

Amino Acid Sequence: KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55124 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PACT Recombinant Protein Antigen

  • DYT16
  • DYT16interferon-inducible double stranded RNA-dependent activator
  • HSD14
  • PACT
  • PACTPKR-associating protein X
  • PKR-associated protein X
  • PKR-Associating Protein X
  • PRKRA
  • protein kinase, interferon-inducible double stranded RNA dependent activator
  • RAX
  • RAXHSD14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NBP3-03780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-71691
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-93163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO

Publications for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no publications for PACT Recombinant Protein Antigen (NBP2-55124PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no reviews for PACT Recombinant Protein Antigen (NBP2-55124PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PACT Products

Bioinformatics Tool for PACT Recombinant Protein Antigen (NBP2-55124PEP)

Discover related pathways, diseases and genes to PACT Recombinant Protein Antigen (NBP2-55124PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACT Recombinant Protein Antigen (NBP2-55124PEP)

Discover more about diseases related to PACT Recombinant Protein Antigen (NBP2-55124PEP).
 

Pathways for PACT Recombinant Protein Antigen (NBP2-55124PEP)

View related products by pathway.

PTMs for PACT Recombinant Protein Antigen (NBP2-55124PEP)

Learn more about PTMs related to PACT Recombinant Protein Antigen (NBP2-55124PEP).
 

Research Areas for PACT Recombinant Protein Antigen (NBP2-55124PEP)

Find related products by research area.

Blogs on PACT

There are no specific blogs for PACT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut1 Antibody
NB110-39113

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PACT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRA