PACSIN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP1-87067] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PACSIN1 antibody. Corresponding PACSIN1 RNA-seq data are presented for the same tissues.

Western Blot: PACSIN1 Antibody [NBP1-87067] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP1-87067] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP1-87067] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PACSIN1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNW
• Predicted Species: Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PACSIN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PACSIN1 Protein (NBP1-87067PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PACSIN1 Antibody - BSA Free

• KIAA1379SDPI
• protein kinase C and casein kinase substrate in neurons 1
• protein kinase C and casein kinase substrate in neurons protein 1
• syndapin I

Background

PACSINs are a family of cytoplasmic phosphoproteins that play a role in vesicle formation and transport. Highly expressed in brain and to a lesser extent in heart, pancreas and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PACSIN1 Antibody (NBP1-87067)(2)

Publications using NBP1-87067

• Martellucci S, Flütsch A, Carter M, Norimoto M et Al. Axon-derived PACSIN1 binds to the Schwann cell survival receptor, LRP1, and transactivates TrkC to promote gliatrophic activities Glia 2024-02-19 [PMID: 38372375]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: PACSIN1