PACSIN1 Antibody

Images

 
Western Blot: PACSIN1 Antibody [NBP1-87067] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP1-87067] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PACSIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PACSIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PACSIN1 Protein (NBP1-87067PEP)
Publications
Read Publication using NBP1-87067.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PACSIN1 Antibody

  • KIAA1379SDPI
  • protein kinase C and casein kinase substrate in neurons 1
  • protein kinase C and casein kinase substrate in neurons protein 1
  • syndapin I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-03475
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-87067
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PACSIN1 Antibody (NBP1-87067)(1)

Reviews for PACSIN1 Antibody (NBP1-87067) (0)

There are no reviews for PACSIN1 Antibody (NBP1-87067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PACSIN1 Antibody (NBP1-87067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PACSIN1 Products

Bioinformatics Tool for PACSIN1 Antibody (NBP1-87067)

Discover related pathways, diseases and genes to PACSIN1 Antibody (NBP1-87067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACSIN1 Antibody (NBP1-87067)

Discover more about diseases related to PACSIN1 Antibody (NBP1-87067).
 

Pathways for PACSIN1 Antibody (NBP1-87067)

View related products by pathway.

PTMs for PACSIN1 Antibody (NBP1-87067)

Learn more about PTMs related to PACSIN1 Antibody (NBP1-87067).

Blogs on PACSIN1

There are no specific blogs for PACSIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACSIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PACSIN1