PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen

Images

 
There are currently no images for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PA28 Activator beta Subunit/PSME2.

Source: E. coli

Amino Acid Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSME2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57628.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen

  • 11S regulator complex beta subunit
  • 11S regulator complex subunit beta
  • Activator of multicatalytic protease subunit 2
  • MCP Activator
  • MCP activator, 31-kD subunit
  • PA28 Activator beta Subunit
  • PA28b
  • PA28betacell migration-inducing protein 22
  • proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
  • Proteasome activator 28 subunit beta
  • proteasome activator 28-beta
  • proteasome activator complex subunit 2
  • proteasome activator hPA28 subunit beta
  • PSME2
  • REGbeta
  • REG-beta

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83121
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-33498
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
485-MI
Species: Mu
Applications: BA
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1657
Species: Mu
Applications: WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
AF2818
Species: Hu
Applications: ICC, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
NBP2-57628PEP
Species: Hu
Applications: AC

Publications for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP) (0)

There are no publications for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP) (0)

There are no reviews for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PA28 Activator beta Subunit/PSME2 Products

Research Areas for PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP)

Find related products by research area.

Blogs on PA28 Activator beta Subunit/PSME2

There are no specific blogs for PA28 Activator beta Subunit/PSME2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME2