PA28 Activator alpha Subunit/PSME1 Antibody

Images

 
Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B02P] - Analysis of PSME1 expression in human kidney.
Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B02P] - Analysis of PSME1 expression in transfected 293T cell line by PSME1 polyclonal antibody. Lane 1: PSME1 transfected lysate(27.39 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PA28 Activator alpha Subunit/PSME1 Antibody Summary

Immunogen
PSME1 (NP_006254.1, 1 a.a. - 249 a.a.) full-length human protein. MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PSME1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PA28 Activator alpha Subunit/PSME1 Antibody

  • 11S regulator complex alpha subunit
  • 11S Regulator Complex Subunit alpha
  • 29-kD MCP activator subunit
  • IFI5111
  • IFI5111MGC8628
  • IGUP I-5111
  • Interferon gamma up-regulated I-5111 protein
  • interferon-gamma IEF SSP 5111
  • interferon-gamma-inducible protein 5111
  • PA28 Activator alpha Subunit
  • PA28A
  • PA28alphaActivator of multicatalytic protease subunit 1
  • proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
  • Proteasome activator 28 subunit alpha
  • proteasome activator complex subunit 1
  • proteasome activator subunit-1
  • PSME1
  • REG alpha
  • REGalpha
  • REG-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-33498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF5540
Species: Mu
Applications: WB
H00005720-B02P
Species: Hu
Applications: WB

Publications for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P) (0)

There are no publications for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P) (0)

There are no reviews for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA28 Activator alpha Subunit/PSME1 Products

Bioinformatics Tool for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P)

Discover related pathways, diseases and genes to PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P)

Discover more about diseases related to PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P).
 

Pathways for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P)

View related products by pathway.

PTMs for PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P)

Learn more about PTMs related to PA28 Activator alpha Subunit/PSME1 Antibody (H00005720-B02P).

Blogs on PA28 Activator alpha Subunit/PSME1

There are no specific blogs for PA28 Activator alpha Subunit/PSME1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator alpha Subunit/PSME1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME1
Entrez
Uniprot