p70 S6 Kinase/S6K Recombinant Protein Antigen

Images

 
There are currently no images for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p70 S6 Kinase/S6K Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KB1.

Source: E. coli

Amino Acid Sequence: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPS6KB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38448.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p70 S6 Kinase/S6K Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • p70 ribosomal S6 kinase alpha
  • p70 S6 kinase alpha
  • p70 S6 Kinase
  • p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1
  • p70 S6 kinase, alpha 2
  • p70 S6KA
  • p70 S6K-alpha
  • p70(S6K)-alpha
  • p70-alpha
  • p70-S6K
  • P70S6K1
  • PS6K
  • ribosomal protein S6 kinase beta-1
  • Ribosomal protein S6 kinase I
  • ribosomal protein S6 kinase, 70kD, polypeptide 1
  • ribosomal protein S6 kinase, 70kDa, polypeptide 1
  • RPS6KB1
  • S6K
  • S6K1
  • S6K1p70-S6K 1
  • S6K-beta-1
  • serine/threonine kinase 14 alpha
  • Serine/threonine-protein kinase 14A
  • STK14A

Background

S6K encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6696
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF4589
Species: Hu
Applications: IHC, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB79671
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP) (0)

There are no publications for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP) (0)

There are no reviews for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p70 S6 Kinase/S6K Products

Research Areas for p70 S6 Kinase/S6K Recombinant Protein Antigen (NBP2-38448PEP)

Find related products by research area.

Blogs on p70 S6 Kinase/S6K.

S6K - a serine/threonine kinase with diverse roles in cell survival and cell cycle progression
S6K is a serine/threonine kinase that is a member of the ribosomal S6 kinase (RSK) family. S6K exists in two main isoforms, S6K1 and S6K2, which can also be alternatively spliced to produce different splice forms. S6K1 has two major splicing produ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p70 S6 Kinase/S6K Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KB1