P4HA3 Antibody - Azide and BSA Free

Western Blot: P4HA3 Antibody [NBP2-94641] - Western blot analysis of extracts of various cell lines, using P4HA3 antibody (NBP2-94641) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.

Western Blot: P4HA3 Antibody [NBP2-94641] - Analysis of extracts of 293T cells, using P4HA3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:

Immunocytochemistry/ Immunofluorescence: P4HA3 Antibody - Azide and BSA Free [P4HA3] - Immunofluorescence analysis of NIH/3T3 cells using P4HA3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

P4HA3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit P4HA3 Antibody - Azide and BSA Free (NBP2-94641) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P4HA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for P4HA3 Antibody - Azide and BSA Free

• 2-oxoglutarate-4-dioxygenase subunit alpha-3
• 4-PH alpha-3
• alpha polypeptide III
• collagen prolyl 4-hydroxylase alpha(III)
• C-P4H alpha III
• C-P4Halpha(III)
• EC 1.14.11.2
• Procollagen-proline
• procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
• prolyl 4-hydroxylase subunit alpha-3
• prolyl 4-hydroxylase, alpha polypeptide III

Background

The P4HA3 gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: P4HA3