p38 gamma/SAPK3 Antibody

Images

 
Western Blot: p38 gamma/SAPK3 Antibody [NBP2-38729] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry: p38 gamma/SAPK3 Antibody [NBP2-38729] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p38 gamma/SAPK3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Specificity
Specificity of human p38 gamma/SAPK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
p38 gamma/SAPK3 Lysate (NBP2-65634)
Control Peptide
p38 gamma/SAPK3 Protein (NBP2-38729PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p38 gamma/SAPK3 Antibody

  • EC 2.7.11
  • ERK3
  • ERK-6
  • ERK6MAPK 12
  • Extracellular signal-regulated kinase 6
  • MAP kinase 12
  • MAP kinase p38 gamma
  • MAPK12
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase p38 gamma
  • p38 gamma
  • p38gamma
  • PRKM12
  • SAPK-3
  • SAPK3EC 2.7.11.24
  • Stress-activated protein kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55380
Species: Hu
Applications: WB
NBP2-38729
Species: Hu
Applications: WB, IHC, IHC-P

Publications for p38 gamma/SAPK3 Antibody (NBP2-38729) (0)

There are no publications for p38 gamma/SAPK3 Antibody (NBP2-38729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 gamma/SAPK3 Antibody (NBP2-38729) (0)

There are no reviews for p38 gamma/SAPK3 Antibody (NBP2-38729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p38 gamma/SAPK3 Antibody (NBP2-38729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for p38 gamma/SAPK3 Antibody (NBP2-38729)

Discover related pathways, diseases and genes to p38 gamma/SAPK3 Antibody (NBP2-38729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 gamma/SAPK3 Antibody (NBP2-38729)

Discover more about diseases related to p38 gamma/SAPK3 Antibody (NBP2-38729).
 

Pathways for p38 gamma/SAPK3 Antibody (NBP2-38729)

View related products by pathway.

PTMs for p38 gamma/SAPK3 Antibody (NBP2-38729)

Learn more about PTMs related to p38 gamma/SAPK3 Antibody (NBP2-38729).
 

Research Areas for p38 gamma/SAPK3 Antibody (NBP2-38729)

Find related products by research area.

Blogs on p38 gamma/SAPK3

There are no specific blogs for p38 gamma/SAPK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 gamma/SAPK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK12
Uniprot