p38 gamma/SAPK3 Antibody (1G3)

Images

 
Western Blot: p38 gamma/SAPK3 Antibody (1G3) [H00006300-M06] - Analysis of MAPK12 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: p38 gamma/SAPK3 Antibody (1G3) [H00006300-M06] - Analysis of monoclonal antibody to MAPK12 on HeLa cell. Antibody concentration 25 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p38 gamma/SAPK3 Antibody (1G3) Summary

Immunogen
MAPK12 (AAH15741, 251 a.a. - 367 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Specificity
MAPK12 (1G3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 gamma/SAPK3 Antibody (1G3)

  • EC 2.7.11
  • ERK3
  • ERK-6
  • ERK6MAPK 12
  • Extracellular signal-regulated kinase 6
  • MAP kinase 12
  • MAP kinase p38 gamma
  • MAPK12
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase p38 gamma
  • p38 gamma
  • p38gamma
  • PRKM12
  • SAPK-3
  • SAPK3EC 2.7.11.24
  • Stress-activated protein kinase 3

Background

Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
H00006300-M06
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for p38 gamma/SAPK3 Antibody (H00006300-M06) (0)

There are no publications for p38 gamma/SAPK3 Antibody (H00006300-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 gamma/SAPK3 Antibody (H00006300-M06) (0)

There are no reviews for p38 gamma/SAPK3 Antibody (H00006300-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p38 gamma/SAPK3 Antibody (H00006300-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p38 gamma/SAPK3 Products

Bioinformatics Tool for p38 gamma/SAPK3 Antibody (H00006300-M06)

Discover related pathways, diseases and genes to p38 gamma/SAPK3 Antibody (H00006300-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 gamma/SAPK3 Antibody (H00006300-M06)

Discover more about diseases related to p38 gamma/SAPK3 Antibody (H00006300-M06).
 

Pathways for p38 gamma/SAPK3 Antibody (H00006300-M06)

View related products by pathway.

PTMs for p38 gamma/SAPK3 Antibody (H00006300-M06)

Learn more about PTMs related to p38 gamma/SAPK3 Antibody (H00006300-M06).
 

Research Areas for p38 gamma/SAPK3 Antibody (H00006300-M06)

Find related products by research area.

Blogs on p38 gamma/SAPK3

There are no specific blogs for p38 gamma/SAPK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 gamma/SAPK3 Antibody (1G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK12
Entrez
OMIM
Uniprot