P2X5/P2RX5 Antibody

Images

 
Western Blot: P2X5/P2RX5 Antibody [NBP1-82441] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-408
Immunocytochemistry/ Immunofluorescence: P2X5/P2RX5 Antibody [NBP1-82441] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: P2X5/P2RX5 Antibody [NBP1-82441] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of lymphoid cells.
Immunohistochemistry-Paraffin: P2X5/P2RX5 Antibody [NBP1-82441] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P2X5/P2RX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Specificity
Specificity of human P2X5/P2RX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P2RX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
P2X5/P2RX5 Protein (NBP1-82441PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P2X5/P2RX5 Antibody

  • ATP receptor subunit
  • ATP receptor
  • ionotropic ATP receptor P2X5
  • LRH-1
  • MGC47755
  • P2RX5
  • P2X purinoceptor 5
  • P2X5
  • P2X5lymphoid-restricted histocompatibility antigen-1
  • P2X5R
  • purinergic receptor P2X ligand gated ion channel 5
  • purinergic receptor P2X, ligand-gated ion channel, 5
  • Purinergic receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Pm
Applications: WB, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-92239
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1654
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
MAB9120
Species: Hu
Applications: ICC
PP-H7431-00
Species: Hu
Applications: WB
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for P2X5/P2RX5 Antibody (NBP1-82441) (0)

There are no publications for P2X5/P2RX5 Antibody (NBP1-82441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X5/P2RX5 Antibody (NBP1-82441) (0)

There are no reviews for P2X5/P2RX5 Antibody (NBP1-82441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for P2X5/P2RX5 Antibody (NBP1-82441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for P2X5/P2RX5 Antibody (NBP1-82441)

Discover related pathways, diseases and genes to P2X5/P2RX5 Antibody (NBP1-82441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X5/P2RX5 Antibody (NBP1-82441)

Discover more about diseases related to P2X5/P2RX5 Antibody (NBP1-82441).
 

Pathways for P2X5/P2RX5 Antibody (NBP1-82441)

View related products by pathway.

PTMs for P2X5/P2RX5 Antibody (NBP1-82441)

Learn more about PTMs related to P2X5/P2RX5 Antibody (NBP1-82441).

Blogs on P2X5/P2RX5

There are no specific blogs for P2X5/P2RX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2X5/P2RX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX5
Entrez