| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Mycoplasma |
| Clone | 1C5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP |
| Localization | Integral membrane protein. |
| Specificity | P2RX5 - purinergic receptor P2X, ligand-gated ion channel, 5 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | P2RX5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00005026-M01 | Applications | Species |
|---|---|---|
| Abramowski P, Ogrodowczyk C, Martin R, Pongs O. A Truncation Variant of the Cation Channel P2RX5 Is Upregulated during T Cell Activation. PLoS One. 2014-09-02 [PMID: 25181038] |
Secondary Antibodies |
Isotype Controls |
Research Areas for P2X5/P2RX5 Antibody (H00005026-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.