p23/PTGES3 Recombinant Protein Antigen

Images

 
There are currently no images for p23/PTGES3 Protein (NBP1-85485PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p23/PTGES3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGES3.

Source: E. coli

Amino Acid Sequence: CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTGES3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85485.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p23/PTGES3 Recombinant Protein Antigen

  • CPGES
  • cPGESp23
  • Cytosolic prostaglandin E2 synthase
  • Hsp90 co-chaperone
  • p23
  • P23cytosolic prostaglandin E synthase
  • Progesterone receptor complex p23
  • prostaglandin E synthase 3 (cytosolic)
  • prostaglandin E synthase 3
  • PTGES3
  • TEBP
  • TEBPEC 5.3.99.3
  • Telomerase-binding protein p23
  • unactive progesterone receptor, 23 kD

Background

Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP 70 and HSP 90), immunosuppressant binding proteins called immunophilins (the FK 506 binding proteins, FKBP 52 & FKBP 54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP 70, HSP 90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP 90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87852
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-45904
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC,  IHC-P, IP, WB
NBP1-85485PEP
Species: Hu
Applications: AC

Publications for p23/PTGES3 Protein (NBP1-85485PEP) (0)

There are no publications for p23/PTGES3 Protein (NBP1-85485PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p23/PTGES3 Protein (NBP1-85485PEP) (0)

There are no reviews for p23/PTGES3 Protein (NBP1-85485PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p23/PTGES3 Protein (NBP1-85485PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p23/PTGES3 Products

Research Areas for p23/PTGES3 Protein (NBP1-85485PEP)

Find related products by research area.

Blogs on p23/PTGES3

There are no specific blogs for p23/PTGES3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p23/PTGES3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGES3