p190RhoGAP Antibody (4D4-F8) - Azide and BSA Free

Sandwich ELISA: p190RhoGAP Antibody (4D4-F8) [H00002909-M01] - Detection limit for recombinant GST tagged GRLF1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 4D4-F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

p190RhoGAP Antibody (4D4-F8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GRLF1 (AAH03514, 1 a.a. ~ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
• Specificity: GRLF1 - glucocorticoid receptor DNA binding factor 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ARHGAP35
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p190RhoGAP Antibody (4D4-F8) - Azide and BSA Free

• glucocorticoid receptor DNA binding factor 1
• glucocorticoid receptor DNA-binding factor 1
• glucocorticoid receptor repression factor 1
• GRF1
• GRF-1
• GRLF1
• KIAA1722
• MGC10745
• P190A
• P190-A
• p190ARhoGAP
• p190RhoGAP
• rho GAP p190A
• Rho GTPase activating protein 35
• rho GTPase-activating protein 35

Background

The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP35
• Entrez:
  • 2909(Human)
• OMIM:
  • 605277(Human)