p19 INK4d Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: p19 INK4d Antibody [NBP2-58778] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p19 INK4d Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
Specificity
Specificity of human p19 INK4d antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKN2D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for p19 INK4d Antibody

  • CDK inhibitor p19INK4d
  • cell cycle inhibitor, Nur77 associating protein
  • cyclin-dependent kinase 4 inhibitor D p19
  • cyclin-dependent kinase 4 inhibitor D
  • cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
  • inhibitor of cyclin-dependent kinase 4d
  • INK4D
  • p19
  • p19-INK4D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-31308
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-709
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58778
Species: Hu
Applications: ICC/IF

Publications for p19 INK4d Antibody (NBP2-58778) (0)

There are no publications for p19 INK4d Antibody (NBP2-58778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p19 INK4d Antibody (NBP2-58778) (0)

There are no reviews for p19 INK4d Antibody (NBP2-58778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for p19 INK4d Antibody (NBP2-58778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional p19 INK4d Products

Bioinformatics Tool for p19 INK4d Antibody (NBP2-58778)

Discover related pathways, diseases and genes to p19 INK4d Antibody (NBP2-58778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p19 INK4d Antibody (NBP2-58778)

Discover more about diseases related to p19 INK4d Antibody (NBP2-58778).
 

Pathways for p19 INK4d Antibody (NBP2-58778)

View related products by pathway.

PTMs for p19 INK4d Antibody (NBP2-58778)

Learn more about PTMs related to p19 INK4d Antibody (NBP2-58778).
 

Research Areas for p19 INK4d Antibody (NBP2-58778)

Find related products by research area.

Blogs on p19 INK4d

There are no specific blogs for p19 INK4d, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p19 INK4d Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2D
Novus 100% Guarantee