p15INK4b/CDKN2B Antibody (8C4)

Images

 
Western Blot: p15INK4b/CDKN2B Antibody (8C4) [H00001030-M07] - Analysis of CDKN2B expression in transfected 293T cell line by CDKN2B monoclonal antibody (M07), clone 8C4. Lane 1: CDKN2B transfected lysatE (14.7 KDa). ...read more
Sandwich ELISA: p15INK4b/CDKN2B Antibody (8C4) [H00001030-M07] - Detection limit for recombinant GST tagged CDKN2B is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p15INK4b/CDKN2B Antibody (8C4) Summary

Immunogen
CDKN2B (AAH14469, 1 a.a. - 138 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKN2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p15INK4b/CDKN2B Antibody (8C4)

  • CDK4I
  • CDKN2B
  • cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
  • cyclin-dependent kinases 4 and 6 binding protein
  • INK4BCDK4B inhibitor
  • MTS2
  • MTS-2
  • MTS2CDK inhibitory protein
  • Multiple tumor suppressor 2
  • p14_CDK inhibitor
  • p14_INK4B
  • p14-INK4b
  • p15 CDK inhibitor
  • p15_INK4B
  • P15cyclin-dependent kinase 4 inhibitor B
  • p15INK4b
  • p15-INK4b
  • TP15

Background

This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
AF1555
Species: Hu
Applications: WB
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
H00001030-M07
Species: Hu
Applications: WB, ELISA

Publications for p15INK4b/CDKN2B Antibody (H00001030-M07) (0)

There are no publications for p15INK4b/CDKN2B Antibody (H00001030-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p15INK4b/CDKN2B Antibody (H00001030-M07) (0)

There are no reviews for p15INK4b/CDKN2B Antibody (H00001030-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p15INK4b/CDKN2B Antibody (H00001030-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p15INK4b/CDKN2B Products

Bioinformatics Tool for p15INK4b/CDKN2B Antibody (H00001030-M07)

Discover related pathways, diseases and genes to p15INK4b/CDKN2B Antibody (H00001030-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p15INK4b/CDKN2B Antibody (H00001030-M07)

Discover more about diseases related to p15INK4b/CDKN2B Antibody (H00001030-M07).
 

Pathways for p15INK4b/CDKN2B Antibody (H00001030-M07)

View related products by pathway.

PTMs for p15INK4b/CDKN2B Antibody (H00001030-M07)

Learn more about PTMs related to p15INK4b/CDKN2B Antibody (H00001030-M07).
 

Research Areas for p15INK4b/CDKN2B Antibody (H00001030-M07)

Find related products by research area.

Blogs on p15INK4b/CDKN2B

There are no specific blogs for p15INK4b/CDKN2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p15INK4b/CDKN2B Antibody (8C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2B
Entrez
Uniprot