Recombinant Human p130 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human p130 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 416-515 of Human RBL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p130 Protein

  • FLJ26459
  • P130
  • PRB2
  • Rb2
  • RBR-2
  • retinoblastoma-like 2 (p130)
  • retinoblastoma-like protein 2,130 kDa retinoblastoma-associated protein
  • Retinoblastoma-related protein 2

Background

RBL2 - retinoblastoma-like 2 (p130)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NSB624
Species: Hu, Mu, Rt, Ch, Dr, Fe, Pm, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-26616
Species: Hu
Applications: WB, IP
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1555
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00005934-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no publications for p130 Partial Recombinant Protein (H00005934-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no reviews for p130 Partial Recombinant Protein (H00005934-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p130 Products

Bioinformatics Tool for p130 Partial Recombinant Protein (H00005934-Q01)

Discover related pathways, diseases and genes to p130 Partial Recombinant Protein (H00005934-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p130 Partial Recombinant Protein (H00005934-Q01)

Discover more about diseases related to p130 Partial Recombinant Protein (H00005934-Q01).
 

Pathways for p130 Partial Recombinant Protein (H00005934-Q01)

View related products by pathway.

PTMs for p130 Partial Recombinant Protein (H00005934-Q01)

Learn more about PTMs related to p130 Partial Recombinant Protein (H00005934-Q01).
 

Research Areas for p130 Partial Recombinant Protein (H00005934-Q01)

Find related products by research area.

Blogs on p130

There are no specific blogs for p130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p130 Antibody
NBP1-82455

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p130 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBL2