p120-catenin Antibody

Images

 
Orthogonal Strategies: Western Blot: p120-catenin Antibody [NBP1-85383] - Analysis in human cell lines A-431 and HEK293 using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: p120-catenin Antibody [NBP1-85383] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p120-catenin Antibody [NBP1-85383] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.
Western Blot: p120-catenin Antibody [NBP1-85383] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

p120-catenin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR
Specificity
Specificity of human, mouse, rat p120-catenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTNND1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
p120-catenin Lysate (NBP2-64652)
Control Peptide
p120-catenin Protein (NBP1-85383PEP)
Publications
Read Publication using NBP1-85383.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p120-catenin Antibody

  • Cadherin-associated Src substrate
  • CAS
  • catenin (cadherin-associated protein), delta 1
  • catenin delta-1
  • CTNND
  • KIAA0384P120CAS
  • p120 catenin
  • p120
  • p120(CAS)
  • p120(CTN)
  • p120cas
  • p120ctn

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-1699
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p120-catenin Antibody (NBP1-85383)(1)

Reviews for p120-catenin Antibody (NBP1-85383) (0)

There are no reviews for p120-catenin Antibody (NBP1-85383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p120-catenin Antibody (NBP1-85383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for p120-catenin Antibody (NBP1-85383)

Discover related pathways, diseases and genes to p120-catenin Antibody (NBP1-85383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p120-catenin Antibody (NBP1-85383)

Discover more about diseases related to p120-catenin Antibody (NBP1-85383).
 

Pathways for p120-catenin Antibody (NBP1-85383)

View related products by pathway.

PTMs for p120-catenin Antibody (NBP1-85383)

Learn more about PTMs related to p120-catenin Antibody (NBP1-85383).
 

Research Areas for p120-catenin Antibody (NBP1-85383)

Find related products by research area.

Blogs on p120-catenin

There are no specific blogs for p120-catenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p120-catenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND1