Recombinant Human p114RhoGEF GST (N-Term) Protein

SDS-Page: Recombinant Human p114RhoGEF Protein [H00023370-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human p114RhoGEF GST (N-Term) Protein Summary

• Description: Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-89 of Human ARHGEF18
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ARHGEF18
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 35.8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p114RhoGEF GST (N-Term) Protein

• 114 kDa Rho-specific guanine nucleotide exchange factor
• EC 3.4.24
• EC 3.6.1
• KIAA0521rho guanine nucleotide exchange factor 18
• MGC15913
• p114RhoGEF
• P114-RhoGEF
• P114-RHO-GEF
• Rho/Rac guanine nucleotide exchange factor (GEF) 18
• Rho/Rac guanine nucleotide exchange factor 18
• Rho-specific guanine nucleotide exchange factor p114
• SA-RhoGEF
• Septin-associated RhoGEF

Background

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF18